Property Summary

NCBI Gene PubMed Count 24
Grant Count 5
Funding $374,649
PubMed Score 0.00
PubTator Score 12.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -3.000 0.000
osteosarcoma -2.069 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.700 0.000

Gene RIF (7)

PMID Text
23894563 Expression of the ARPC4 severely affects mycobacterium tuberculosis growth and suppresses immunogenic response in murine macrophages
23267127 we show cell line-specific differences in ARP2/3 complex subunit dependency on cell migratory potential, and suggest ARPC4 to be one of the key members of the ARP2/3 complex in pancreatic cancer.
23125841 Tandem affinity purification and mass spectrometry analysis identify 20kDa subunit 4 of actin related protein 2/3 complex (ARPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 20kDa subunit 4 of actin related protein 2/3 complex (ARPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 20kDa subunit 4 of actin related protein 2/3 complex (ARPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 20kDa subunit 4 of actin related protein 2/3 complex (ARPC4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
17274980 We show that coronin 3 similar to other coronins interacts with the Arp2/3-complex and cofilin indicating that this family in general is involved in regulating Arp2/3-mediated events.

AA Sequence

MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEGSINSV      1 - 70
RVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFME     71 - 140
EIDKEISEMKLSVNARARIVAEEFLKNF                                              141 - 168
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23921388 2013 Identification and characterization of a novel human methyltransferase modulating Hsp70 protein function through lysine methylation.
23894563 2013 Expression of the ARPC4 subunit of human Arp2/3 severely affects mycobacterium tuberculosis growth and suppresses immunogenic response in murine macrophages.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23267127 2013 Silencing of the ARP2/3 complex disturbs pancreatic cancer cell migration.
20959098 2010 Molecular dynamics simulations of Arp2/3 complex activation.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20404198 2010 An actin-filament-binding interface on the Arp2/3 complex is critical for nucleation and branch stability.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18805923 2008 Molecular dynamics simulation and coarse-grained analysis of the Arp2/3 complex.
More...