Property Summary

NCBI Gene PubMed Count 25
PubMed Score 0.00
PubTator Score 12.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 4.3e-04
medulloblastoma, large-cell -1.700 2.5e-04
osteosarcoma -2.069 3.1e-08
psoriasis -3.000 3.1e-05

Gene RIF (4)

AA Sequence

MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEGSINSV      1 - 70
RVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFME     71 - 140
EIDKEISEMKLSVNARARIVAEEFLKNF                                              141 - 168
//

Text Mined References (26)

PMID Year Title