Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.61
PubTator Score 2.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.4e-04

AA Sequence

MCHTSCSSGCQPACCAPSPCQASCYIPVGCQSSVCVPVSFKPAVCVPVRCQSSVCVPVSCRPVVYAAPSC      1 - 70
QSSGCCQPSCTSVLCRPISCSTPSCC                                                 71 - 96
//

Text Mined References (6)

PMID Year Title