Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.25
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (3)

AA Sequence

MVLPLPWLSRYHFLRLLLPSWSLAPQGSHGCCSQNPKASMEEQTSSRGNGKMTSPPRGPGTHRTAELARA      1 - 70
EELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQMRRHQESLGGGA                          71 - 119
//

Text Mined References (8)

PMID Year Title