Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MDQKNGSSFTGFILLGFSDRPQLELVLFVVLLIFYIFTLLGNKTIIVLSHLDPHLHTPMYFFFSNLSFLD      1 - 70
LCYTTGIVPQLLVNLRGADKSISYGGCVVQLYISLGLGSTECVLLGVMVFDRYAAVCRPLHYTVVMHPCL     71 - 140
YVLMASTSWVIGFANSLLQTVLILLLTLCGRNKLEHFLCEVPPLLKLACVDTTMNESELFFVSVIILLVP    141 - 210
VALIIFSYSQIVRAVMRIKLATGQRKVFGTCGSHLTVVSLFYGTAIYAYLQPGNNYSQDQGKFISLFYTI    211 - 280
ITPMINPLIYTLRNKDVKGALKKVLWKNYDSR                                          281 - 312
//

Text Mined References (1)

PMID Year Title
14574404 2003 The DNA sequence and analysis of human chromosome 6.