Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.33
PubTator Score 4.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.180 0.000
posterior fossa group B ependymoma 2.100 0.000
nasopharyngeal carcinoma -1.200 0.000
ovarian cancer 1.700 0.000

Gene RIF (2)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)
14970903 TSARG6 is specifically expressed in adult testis with a transcript of 1.8 kb, which has a role in spermatogenesis and apoptosis

AA Sequence

MGQDYYSVLGITRNSEDAQIKQAYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEE      1 - 70
GLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQV     71 - 140
ERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPAD    141 - 210
IIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPL    211 - 280
PEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT                                      281 - 316
//

Text Mined References (6)

PMID Year Title
27486783 2016 Mutations in DNAJB13, Encoding an HSP40 Family Member, Cause Primary Ciliary Dyskinesia and Male Infertility.
21994455 2011 Generation and comprehensive analysis of an influenza virus polymerase cellular interaction network.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
14970903 2004 Molecular cloning of TSARG6 gene related to apoptosis in human spermatogenic cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12673577 2003 [Molecular cloning of TSARG3 gene related to apoptosis in human spermatogenic cells].