Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.22
PubTator Score 12.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Leukemia, Lymphocytic, Chronic, B-Cell 34 0.0 0.0
Disease Target Count
Chronic Lymphocytic Leukemia 262
Disease Target Count P-value
psoriasis 6694 1.3e-29
osteosarcoma 7950 4.1e-09
ovarian cancer 8520 1.5e-07
cutaneous lupus erythematosus 1057 5.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.573 2.2e-02
cutaneous lupus erythematosus 2.900 5.1e-04
osteosarcoma -1.868 4.1e-09
ovarian cancer 1.200 1.5e-07
psoriasis 1.700 1.3e-29

Gene RIF (10)

AA Sequence

MTLILTSLLFFGLSLGPRTRVQAENLPKPILWAEPGPVITWHNPVTIWCQGTLEAQGYRLDKEGNSMSRH      1 - 70
ILKTLESENKVKLSIPSMMWEHAGRYHCYYQSPAGWSEPSDPLELVVTAYSRPTLSALPSPVVTSGVNVT     71 - 140
LRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPS    141 - 210
DPLQLLVSGVSRKPSLLTLQGPVVTPGENLTLQCGSDVGYIRYTLYKEGADGLPQRPGRQPQAGLSQANF    211 - 280
TLSPVSRSYGGQYRCYGAHNVSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPM    281 - 350
FTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGA    351 - 420
TETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQHSQRSPPRCSQEANSRKDNAPF    421 - 490
RVVEPWEQI                                                                 491 - 499
//

Text Mined References (20)

PMID Year Title