Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.89
PubTator Score 2.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 3.700 0.000
osteosarcoma -1.090 0.037
sonic hedgehog group medulloblastoma 2.900 0.000
lung adenocarcinoma -1.200 0.000
nasopharyngeal carcinoma -1.500 0.000
lung carcinoma -1.100 0.005
chronic rhinosinusitis -1.986 0.023

Gene RIF (1)

PMID Text
12820024 DCDC1 was mapped to 11p13; mainly expressed in adult testis; and its expression in fetal brain was much higher than in adult brain

AA Sequence

MAKTGAEDHREALSQSSLSLLTEAMEVLQQSSPEGTLDGNTVNPIYKYILNDLPREFMSSQAKAVIKTTD      1 - 70
DYLQSQFGPNRLVHSAAVSEGSGLQDCSTHQTASDHSHDEISDLDSYKSNSKNNSCSISASKRNRPVSAP     71 - 140
VGQLRVAEFSSLKFQSARNWQKLSQRHKLQPRVIKVTAYKNGSRTVFARVTVPTITLLLEECTEKLNLNM    141 - 210
AARRVFLADGKEALEPEDIPHEADVYVSTGEPFLNPFKKIKDHLLLIKKVTWTMNGLMLPTDIKRRKTKP    211 - 280
VLSIRMKKLTERTSVRILFFKNGMGQDGHEITVGKETMKKVLDTCTIRMNLNLPARYFYDLYGRKIEDIS    281 - 350
KGKH                                                                      351 - 354
//

Text Mined References (8)

PMID Year Title
21321669 2011 A 556 kb deletion in the downstream region of the PAX6 gene causes familial aniridia and other eye anomalies in a Chinese family.
20236041 2010 The doublecortin gene family and disorders of neuronal structure.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
16869982 2006 The evolving doublecortin (DCX) superfamily.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12820024 2003 Identification of a novel human doublecortin-domain-containing gene (DCDC1) expressed mainly in testis.