Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.19
PubTator Score 2.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
chronic rhinosinusitis -1.986 2.3e-02
ependymoma 2.900 3.2e-02
lung adenocarcinoma -1.200 2.7e-08
lung carcinoma -1.100 5.1e-03
medulloblastoma 1.700 2.7e-02
nasopharyngeal carcinoma -1.500 7.4e-05
osteosarcoma -1.090 3.7e-02

Gene RIF (4)

AA Sequence

MAKTGAEDHREALSQSSLSLLTEAMEVLQQSSPEGTLDGNTVNPIYKYILNDLPREFMSSQAKAVIKTTD      1 - 70
DYLQSQFGPNRLVHSAAVSEGSGLQDCSTHQTASDHSHDEISDLDSYKSNSKNNSCSISASKRNRPVSAP     71 - 140
VGQLRVAEFSSLKFQSARNWQKLSQRHKLQPRVIKVTAYKNGSRTVFARVTVPTITLLLEECTEKLNLNM    141 - 210
AARRVFLADGKEALEPEDIPHEADVYVSTGEPFLNPFKKIKDHLLLIKKVTWTMNGLMLPTDIKRRKTKP    211 - 280
VLSIRMKKLTERTSVRILFFKNGMGQDGHEITVGKETMKKVLDTCTIRMNLNLPARYFYDLYGRKIEDIS    281 - 350
KGKH                                                                      351 - 354
//

Text Mined References (16)

PMID Year Title