Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.65
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MRVLFFVFGVLSLMFTVPPARSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW      1 - 70
//

Text Mined References (6)

PMID Year Title