Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.65
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
18976975 Knockdown of defensin, beta 131 (DEFB131) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
16033865 The protein encoded by this gene is thought to display antimicrobial activity.

AA Sequence

MRVLFFVFGVLSLMFTVPPARSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW      1 - 70
//

Text Mined References (5)

PMID Year Title
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12600824 2003 ORFeome-based search of airway epithelial cell-specific novel human [beta]-defensin genes.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.