Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.64
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (2)

PMID Text
25491355 Overexpression of BPIFB3 inhibits coxsackievirus B replication, dramatically alters the morphology of LC3B-positive vesicles, and suppresses autophagy in response to rapamycin.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQPVMLALWSLLLLWGLATPCQELLETVGTLARIDKDELGKAIQNSLVGEPILQNVLGSVTAVNRGLLGS      1 - 70
GGLLGGGGLLGHGGVFGVVEELSGLKIEELTLPKVLLKLLPGFGVQLSLHTKVGMHCSGPLGGLLQLAAE     71 - 140
VNVTSRVALAVSSRGTPILILKRCSTLLGHISLFSGLLPTPLFGVVEQMLFKVLPGLLCPVVDSVLGVVN    141 - 210
ELLGAVLGLVSLGALGSVEFSLATLPLISNQYIELDINPIVKSVAGDIIDFPKSRAPAKVPPKKDHTSQV    211 - 280
MVPLYLFNTTFGLLQTNGALDMDITPELVPSDVPLTTTDLAALLPEALGKLPLHQQLLLFLRVREAPTVT    281 - 350
LHNKKALVSLPANIHVLFYVPKGTPESLFELNSVMTVRAQLAPSATKLHISLSLERLSVKVASSFTHAFD    351 - 420
GSRLEEWLSHVVGAVYAPKLNVALDVGIPLPKVLNINFSNSVLEIVENAVVLTVAS                  421 - 476
//

Text Mined References (9)

PMID Year Title
25491355 2014 BPIFB3 regulates autophagy and coxsackievirus B replication through a noncanonical pathway independent of the core initiation machinery.
21787333 2011 Systematic nomenclature for the PLUNC/PSP/BSP30/SMGB proteins as a subfamily of the BPI fold-containing superfamily.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
14739326 2004 Phylogenetic and evolutionary analysis of the PLUNC gene family.
12837268 2003 Expansion of the BPI family by duplication on human chromosome 20: characterization of the RY gene cluster in 20q11.21 encoding olfactory transporters/antimicrobial-like peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11971875 2002 PLUNC: a novel family of candidate host defence proteins expressed in the upper airways and nasopharynx.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.