Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.66
PubTator Score 1.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Diabetes Mellitus, Type 2 142 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 8.5e-08
ulcerative colitis 1819 2.4e-06
medulloblastoma, large-cell 6241 4.0e-04
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.200 4.0e-04
ovarian cancer -1.300 8.5e-08
ulcerative colitis -1.400 2.4e-06

Gene RIF (3)

AA Sequence

MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYAT      1 - 70
LYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQ     71 - 140
IEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV                     141 - 193
//

Text Mined References (16)

PMID Year Title