Property Summary

NCBI Gene PubMed Count 61
PubMed Score 10.00
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease -1.555 1.6e-02
active ulcerative colitis -2.061 1.7e-02
adrenocortical carcinoma -1.356 3.9e-02
astrocytoma -1.200 2.4e-12
Astrocytoma, Pilocytic 1.200 2.1e-03
atypical teratoid / rhabdoid tumor -2.500 1.5e-02
autosomal dominant Emery-Dreifuss muscul... 1.060 3.1e-03
breast carcinoma -1.400 3.4e-17
cystic fibrosis 3.392 7.8e-07
Duchenne muscular dystrophy 1.233 6.6e-08
ductal carcinoma in situ -2.100 3.7e-04
ependymoma -1.400 1.0e-03
glioblastoma 1.200 2.1e-04
group 4 medulloblastoma 2.400 9.6e-05
interstitial cystitis 1.400 2.2e-03
intraductal papillary-mucinous adenoma (... -1.600 2.9e-02
intraductal papillary-mucinous carcinoma... -2.300 6.7e-03
intraductal papillary-mucinous neoplasm ... -2.400 2.4e-02
invasive ductal carcinoma -2.900 2.9e-04
lung carcinoma -1.300 6.0e-14
medulloblastoma, large-cell -2.300 1.1e-02
non-small cell lung cancer -1.350 4.0e-13
osteosarcoma -1.702 3.6e-03
ovarian cancer -3.600 2.7e-11
Pick disease -1.800 1.5e-02
pituitary cancer 1.100 1.3e-05
primary Sjogren syndrome 1.900 5.3e-04
primitive neuroectodermal tumor 1.100 3.0e-02
sarcoidosis 1.300 3.6e-03

Gene RIF (15)

AA Sequence

MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI      1 - 70
L//

Text Mined References (67)

PMID Year Title