Property Summary

NCBI Gene PubMed Count 59
Grant Count 4
Funding $374,662.5
PubMed Score 9.82
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
25941381 G-protein betagamma subunits are positive regulators of Kv7.4 and native vascular Kv7 channel activity.
25367286 Alteration of gene expression profiling including GPR174 and GNG2 is associated with vasovagal syncope.
24462769 Data indicate that endogenous mTOR interacts with Gbetagamma.
23031273 increased protein expression level of GNG2 alone inhibits proliferation of malignant melanoma cells in vitro and in vivo
22957104 presence of Gng2 and Netrin-G2 immunoreactive elements in the insular cortex, but not in the putamen, suggests a possible common ontogeny of the claustrum and insula
21679469 Gbetagamma inhibits Epac-induced Ca 2+ elevation in melanoma cells. Cross talk of Ca 2+ signaling between Gbetagamma & Epac plays a major role in melanoma cell migration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20181083 Data implicate the domain I-II linker region as an important contributor to voltage dependent Gbeta1/Ggamma2 modulation of Cav2.2 calcium channels.
20007712 Data show that activation of PLCbeta(2) by alpha(q) and beta1gamma2 differ from activation by Rac2 and from each other.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI      1 - 70
L//

Text Mined References (65)

PMID Year Title
25941381 2015 G-protein ?? subunits are positive regulators of Kv7.4 and native vascular Kv7 channel activity.
25367286 2015 Alteration of gene expression profiling including GPR174 and GNG2 is associated with vasovagal syncope.
24658283 2014 A genome-wide gene-environment interaction analysis for tobacco smoke and lung cancer susceptibility.
24462769 2014 G?? interacts with mTOR and promotes its activation.
23548203 2013 Genome-wide association studies identify several new loci associated with pigmentation traits and skin cancer risk in European Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23031273 2012 Functional analysis of GNG2 in human malignant melanoma cells.
22957104 2012 Topography of Gng2- and NetrinG2-expression suggests an insular origin of the human claustrum.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21827955 2011 Retraction notice to: Structure of the parathyroid hormone receptor C terminus bound to the G-protein dimer G?1?2.
More...