Property Summary

NCBI Gene PubMed Count 59
PubMed Score 9.82
PubTator Score 7.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 3.35504132388874E-17
lung carcinoma 2844 6.038045548624E-14
non-small cell lung cancer 2798 4.04118766652382E-13
astrocytoma 1493 2.44820879729554E-12
ovarian cancer 8492 2.70887626572157E-11
Duchenne muscular dystrophy 602 6.63947643432834E-8
cystic fibrosis 1670 7.83986846679737E-7
glioblastoma 5572 6.66831716849468E-6
pituitary cancer 1972 1.32511630325527E-5
group 4 medulloblastoma 1875 9.61816475060291E-5
interstitial cystitis 2299 1.04936580346324E-4
invasive ductal carcinoma 2950 2.88102305976158E-4
ductal carcinoma in situ 1745 3.70264197868646E-4
primary Sjogren syndrome 789 5.31088281442284E-4
ependymoma 2514 0.00102417550136963
pilocytic astrocytoma 3086 0.00274307832087901
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00312932422548891
sarcoidosis 368 0.00358284926375357
osteosarcoma 7933 0.00362079178602086
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00674850244614828
medulloblastoma, large-cell 6234 0.0114917015611464
atypical teratoid / rhabdoid tumor 4369 0.0146198018382775
Pick disease 1893 0.0152404708533676
active Crohn's disease 918 0.0160746906747804
active ulcerative colitis 477 0.0172304933894052
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0238113487212954
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0287333708781208
primitive neuroectodermal tumor 3031 0.0300868536503221
adrenocortical carcinoma 1427 0.0385012016958332

Expression

Synonym

Accession P59768 Q5JPE2 Q6P9A9
Symbols

Gene

PDB

5HE1   4KFM   5HE0   5HE2   5HE3  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (14)

PMID Text
25941381 G-protein betagamma subunits are positive regulators of Kv7.4 and native vascular Kv7 channel activity.
25367286 Alteration of gene expression profiling including GPR174 and GNG2 is associated with vasovagal syncope.
24462769 Data indicate that endogenous mTOR interacts with Gbetagamma.
23031273 increased protein expression level of GNG2 alone inhibits proliferation of malignant melanoma cells in vitro and in vivo
22957104 presence of Gng2 and Netrin-G2 immunoreactive elements in the insular cortex, but not in the putamen, suggests a possible common ontogeny of the claustrum and insula
21679469 Gbetagamma inhibits Epac-induced Ca 2+ elevation in melanoma cells. Cross talk of Ca 2+ signaling between Gbetagamma & Epac plays a major role in melanoma cell migration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20181083 Data implicate the domain I-II linker region as an important contributor to voltage dependent Gbeta1/Ggamma2 modulation of Cav2.2 calcium channels.
20007712 Data show that activation of PLCbeta(2) by alpha(q) and beta1gamma2 differ from activation by Rac2 and from each other.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI      1 - 70
L//

Text Mined References (65)

PMID Year Title
25941381 2015 G-protein ?? subunits are positive regulators of Kv7.4 and native vascular Kv7 channel activity.
25367286 2015 Alteration of gene expression profiling including GPR174 and GNG2 is associated with vasovagal syncope.
24658283 2014 A genome-wide gene-environment interaction analysis for tobacco smoke and lung cancer susceptibility.
24462769 2014 G?? interacts with mTOR and promotes its activation.
23548203 2013 Genome-wide association studies identify several new loci associated with pigmentation traits and skin cancer risk in European Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23031273 2012 Functional analysis of GNG2 in human malignant melanoma cells.
22957104 2012 Topography of Gng2- and NetrinG2-expression suggests an insular origin of the human claustrum.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21827955 2011 Retraction notice to: Structure of the parathyroid hormone receptor C terminus bound to the G-protein dimer G?1?2.
More...