Property Summary

NCBI Gene PubMed Count 62
PubMed Score 83.97
PubTator Score 83.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 0.028

Synonym

Accession P59666 P11479 Q14125
Symbols HP3
DEF3
HNP3
HP-3
HNP-3

Gene

PDB

1DFN   1ZMH   1ZMI   1ZMK   2PM4   2PM5  

Gene RIF (46)

PMID Text
25300997 The expression of alpha-defensins 1, 2 and 3 is up-regulated in hypercholesteremia.
25083086 Elevated DEFA3 levels in diabetes are independent of DEFA3 copy numbers.
23050799 Results indicate that the gene expression of DEFA 1/3 and 4 was significantly increased in all tumours - except for a significant decrease of DEFA 4 gene expression in pleomorphic adenomas.
23011762 This study suggests that HNPs 1-3 promote tumor invasion and are potential indicators of disease progression in patients with bladder cancer.
22861387 A decrease in salivary HNP 1-3 levels might be a biological factor for predisposition to oral ulcers in patients with Behcet disease and oral infection in healthy patients.
22737966 alpha-Defensin (DEFA3)was the third most differentially overexpressed gene and may be related to the onset of Bell's palsy and Ramsay Hunt Syndrome.
22297599 expressional level of HNPs 1,2 and 3 were significantly higher and their distributions overlapped in cancerous tissues of gastric cancer patients
21861873 Directly isolated dendritic cells secrete alpha-defensins 1-3; E2 inhibits this secretion. Same trend is observed in myeloid dendritic cells isolated from pregnant women in their first trimester (low plasma E2) and third trimester (high plasma E2).
21831449 Increased levels of human neutrophil peptides 1, 2, and 3 in peritoneal fluid of patients with endometriosis: association with neutrophils, T cells and IL-8.
21333105 HNP1-3 concentrations in patients with multidrug-resistant tuberculosis were significantly lower than in drug-susceptible pulmonary TB and healthy controls
More...

AA Sequence

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRI      1 - 70
PACIAGERRYGTCIYQGRLWAFCC                                                   71 - 94
//

Text Mined References (64)

PMID Year Title
25300997 2014 Upregulated expression of human alpha-defensins 1, 2 and 3 in hypercholesteremia and its relationship with serum lipid levels.
25083086 2014 Relevance of ?-defensins (HNP1-3) and defensin ?-1 in diabetes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23050799 2012 Human ?-defensin (DEFA) gene expression helps to characterise benign and malignant salivary gland tumours.
23011762 2013 Plasma human neutrophil proteins-1, -2, and -3 levels in patients with bladder cancer.
22861387 2013 Salivary levels of HNP 1-3 are related to oral ulcer activity in Behçet's disease.
22737966 2012 Alpha-defensin overexpression in patients with Bell's palsy and Ramsay Hunt syndrome.
22297599 2012 Human neutrophil peptides 1-3 as gastric cancer tissue markers measured by MALDI-imaging mass spectrometry: implications for infiltrated neutrophils as a tumor target.
21861873 2011 Alpha-defensins 1-3 release by dendritic cells is reduced by estrogen.
21831449 2011 Increased levels of human neutrophil peptides 1, 2, and 3 in peritoneal fluid of patients with endometriosis: association with neutrophils, T cells and IL-8.
More...