Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
R01 Count 1
Funding $81,639.6
PubMed Score 3.58
PubTator Score 20.99

Knowledge Summary

Patent (1,598)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 0.000

Synonym

Accession P59646 Q6UWZ1 Q7Z4M5
Symbols CHIF

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
12535606 molecular cloning, protein expression, sequencing and NMR structure determination
12217851 CHIF can act as tissue-specific modulators of Na-K-ATPase

AA Sequence

MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQH      1 - 70
SPVPEKAIPLITPGSATTC                                                        71 - 89
//

Text Mined References (10)

PMID Year Title
24478790 2013 Genome wide association and linkage analyses identified three loci-4q25, 17q23.2, and 10q11.21-associated with variation in leukocyte telomere length: the Long Life Family Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12763854 2003 FXYD proteins as regulators of the Na,K-ATPase in the kidney.
12535606 2003 Expression and characterization of the FXYD ion transport regulators for NMR structural studies in lipid micelles and lipid bilayers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12217851 2002 A functional interaction between CHIF and Na-K-ATPase: implication for regulation by FXYD proteins.
11483503 2001 CHIF, a member of the FXYD protein family, is a regulator of Na,K-ATPase distinct from the gamma-subunit.
10950925 2000 The FXYD gene family of small ion transport regulators or channels: cDNA sequence, protein signature sequence, and expression.