Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.29
PubTator Score 20.99

Knowledge Summary

Patent (1,598)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.0e-05
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 3.055 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 3.0e-05

Gene RIF (2)

AA Sequence

MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQH      1 - 70
SPVPEKAIPLITPGSATTC                                                        71 - 89
//

Text Mined References (10)

PMID Year Title