Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.29
PubTator Score 0.42

Knowledge Summary

Patent (1,985)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Melanoma 261

AA Sequence

MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLVSLGASRFCLQ      1 - 70
SVVMGKTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCVKIATFTHPVFFWLKHKLSGW     71 - 140
LPWMLFSSVGLSSFTTILFFIGNHRMYQNYLRNHLQPWNVTGDSIRSYCEKFYLFPLKMITWTMPTAVFF    141 - 210
ICMILLITSLGRHRKKALLTTSGFREPSVQAHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWV    211 - 280
WESVIYLCAAVHPIILLFSNCRLRAVLKSRRSSRCGTP                                    281 - 318
//

Text Mined References (11)

PMID Year Title
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12679530 2003 Adaptive diversification of bitter taste receptor genes in Mammalian evolution.
12584440 2002 Identification and characterization of human taste receptor genes belonging to the TAS2R family.
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12139982 2002 Receptors for bitter and sweet taste.
More...