Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.79
PubTator Score 0.42

Knowledge Summary

Patent (1,985)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

AA Sequence

MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLVSLGASRFCLQ      1 - 70
SVVMGKTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCVKIATFTHPVFFWLKHKLSGW     71 - 140
LPWMLFSSVGLSSFTTILFFIGNHRMYQNYLRNHLQPWNVTGDSIRSYCEKFYLFPLKMITWTMPTAVFF    141 - 210
ICMILLITSLGRHRKKALLTTSGFREPSVQAHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWV    211 - 280
WESVIYLCAAVHPIILLFSNCRLRAVLKSRRSSRCGTP                                    281 - 318
//

Text Mined References (12)

PMID Year Title