Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.11
PubTator Score 4.15

Knowledge Summary

Patent (2,673)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Pelvic inflammatory disease 21 3.248 1.6

Expression

Gene RIF (7)

PMID Text
22192511 Assessment of KIF6 genotype is not useful in predicting low density lipoprotein cholesterol lowering response to pravastatin, and heart disease risk reduction in the elderly.
19817411 TAS2R50 is activated by the natural bitter terpenoids andrographolide and amarogentin.
19709766 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
17967605 Observational study of gene-disease association. (HuGE Navigator)
16175505 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MITFLYIFFSILIMVLFVLGNFANGFIALVNFIDWVKRKKISSADQILTALAVSRIGLLWALLLNWYLTV      1 - 70
LNPAFYSVELRITSYNAWVVTNHFSMWLAANLSIFYLLKIANFSNLLFLHLKRRVRSVILVILLGTLIFL     71 - 140
VCHLLVANMDESMWAEEYEGNMTGKMKLRNTVHLSYLTVTTLWSFIPFTLSLISFLMLICSLCKHLKKMQ    141 - 210
LHGEGSQDLSTKVHIKALQTLISFLLLCAIFFLFLIVSVWSPRRLRNDPVVMVSKAVGNIYLAFDSFILI    211 - 280
WRTKKLKHTFLLILCQIRC                                                       281 - 299
//

Text Mined References (18)

PMID Year Title
22192511 2012 KIF6, LPA, TAS2R50, and VAMP8 genetic variation, low density lipoprotein cholesterol lowering response to pravastatin, and heart disease risk reduction in the elderly.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
19817411 2009 The human bitter taste receptor hTAS2R50 is activated by the two natural bitter terpenoids andrographolide and amarogentin.
19709766 2011 Variations of specific non-candidate genes and risk of myocardial infarction: a replication study.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17967605 2007 Associations with myocardial infarction of six polymorphisms selected from a three-stage genome-wide association study.
16541075 2006 The finished DNA sequence of human chromosome 12.
16175505 2005 Identification of four gene variants associated with myocardial infarction.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
More...