Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.90
PubTator Score 4.15

Knowledge Summary

Patent (2,673)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Pelvic inflammatory disease 21 3.173 1.6
Myocardial Infarction 151 3.172 1.6

Gene RIF (7)

AA Sequence

MITFLYIFFSILIMVLFVLGNFANGFIALVNFIDWVKRKKISSADQILTALAVSRIGLLWALLLNWYLTV      1 - 70
LNPAFYSVELRITSYNAWVVTNHFSMWLAANLSIFYLLKIANFSNLLFLHLKRRVRSVILVILLGTLIFL     71 - 140
VCHLLVANMDESMWAEEYEGNMTGKMKLRNTVHLSYLTVTTLWSFIPFTLSLISFLMLICSLCKHLKKMQ    141 - 210
LHGEGSQDLSTKVHIKALQTLISFLLLCAIFFLFLIVSVWSPRRLRNDPVVMVSKAVGNIYLAFDSFILI    211 - 280
WRTKKLKHTFLLILCQIRC                                                       281 - 299
//

Text Mined References (18)

PMID Year Title