Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.64
PubTator Score 0.33

Knowledge Summary

Patent (1,580)

Expression

AA Sequence

MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLWVILLHWYSTV      1 - 70
LNPTSSNLKVIIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHHLKRKAKSVVLVIVLGSLFFL     71 - 140
VCHLVMKHTYINVWTEECEGNVTWKIKLRNAMHLSNLTVAMLANLIPFTLTLISFLLLIYSLCKHLKKMQ    141 - 210
LHGKGSQDPSTKIHIKALQTVTSFLILLAIYFLCLIISFWNFKMRPKEIVLMLCQAFGIIYPSFHSFILI    211 - 280
WGNKTLKQTFLSVLWQVTCWAKGQNQSTP                                             281 - 309
//

Text Mined References (11)

PMID Year Title
24758778 2014 Frequent expansions of the bitter taste receptor gene repertoire during evolution of mammals in the Euarchontoglires clade.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12584440 2002 Identification and characterization of human taste receptor genes belonging to the TAS2R family.
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379855 2002 The human TAS2R16 receptor mediates bitter taste in response to beta-glucopyranosides.
12139982 2002 Receptors for bitter and sweet taste.
More...