Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.50
PubTator Score 2.12

Knowledge Summary

Patent (1,291)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Bronchiolitis 18 3.393 1.7

Expression

Gene RIF (1)

AA Sequence

MMCFLLIISSILVVFAFVLGNVANGFIALVNVIDWVNTRKISSAEQILTALVVSRIGLLWVMLFLWYATV      1 - 70
FNSALYGLEVRIVASNAWAVTNHFSMWLAASLSIFCLLKIANFSNLISLHLKKRIKSVVLVILLGPLVFL     71 - 140
ICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTTLANLIPFTLSLICFLLLICSLCKHLKKMR    141 - 210
LHSKGSQDPSTKVHIKALQTVTSFLMLFAIYFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILI    211 - 280
MGSRKLKQTFLSVLWQMTR                                                       281 - 299
//

Text Mined References (11)

PMID Year Title