Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.20
PubTator Score 2.12

Knowledge Summary

Patent (1,291)

Expression

Gene RIF (1)

PMID Text
20675712 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MMCFLLIISSILVVFAFVLGNVANGFIALVNVIDWVNTRKISSAEQILTALVVSRIGLLWVMLFLWYATV      1 - 70
FNSALYGLEVRIVASNAWAVTNHFSMWLAASLSIFCLLKIANFSNLISLHLKKRIKSVVLVILLGPLVFL     71 - 140
ICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTTLANLIPFTLSLICFLLLICSLCKHLKKMR    141 - 210
LHSKGSQDPSTKVHIKALQTVTSFLMLFAIYFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILI    211 - 280
MGSRKLKQTFLSVLWQMTR                                                       281 - 299
//

Text Mined References (11)

PMID Year Title
20675712 2010 The perception of quinine taste intensity is associated with common genetic variants in a bitter receptor cluster on chromosome 12.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379855 2002 The human TAS2R16 receptor mediates bitter taste in response to beta-glucopyranosides.
12139982 2002 Receptors for bitter and sweet taste.
More...