Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.92
PubTator Score 0.90

Knowledge Summary

Patent (1,870)



Accession P59541 Q645X7 T2R30
Symbols T2R30


  Ortholog (3)

Species Source
Chimp OMA EggNOG

AA Sequence

LGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRGALCVF                                   281 - 319

Text Mined References (8)

PMID Year Title
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
16541075 2006 The finished DNA sequence of human chromosome 12.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12379855 2002 The human TAS2R16 receptor mediates bitter taste in response to beta-glucopyranosides.
12139982 2002 Receptors for bitter and sweet taste.
11696554 2002 Molecular mechanisms of bitter and sweet taste transduction.