Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.92
PubTator Score 6.32

Knowledge Summary

Patent (4,463)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Pelvic inflammatory disease 21 3.389 1.7

Gene RIF (1)

AA Sequence

MITFLPIIFSILIVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLWVLVLNWYATE      1 - 70
LNPAFNSIEVRITAYNVWAVINHFSNWLATSLSIFYLLKIANFSNLIFLHLKRRVKSVVLVILLGPLLFL     71 - 140
VCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVTILANLVPFTLTLISFLLLICSLCKHLKKMQ    141 - 210
LHGKGSQDPSMKVHIKALQTVTSFLLLCAIYFLSIIMSVWSFESLENKPVFMFCEAIAFSYPSTHPFILI    211 - 280
WGNKKLKQTFLSVLWHVRYWVKGEKPSSS                                             281 - 309
//

Text Mined References (12)

PMID Year Title