Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.21
PubTator Score 6.32

Knowledge Summary

Patent (4,463)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Pelvic inflammatory disease 21 3.747 1.9

Expression

Synonym

Accession P59540 P59548 Q645X6 T2R46
Symbols T2R46
T2R54

Gene

Gene RIF (1)

PMID Text
23520545 MSC express the bitter taste receptor, TAS2R46, a protein more typically localized to the taste bud. Expression was also confirmed in VSMCs.

AA Sequence

MITFLPIIFSILIVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLWVLVLNWYATE      1 - 70
LNPAFNSIEVRITAYNVWAVINHFSNWLATSLSIFYLLKIANFSNLIFLHLKRRVKSVVLVILLGPLLFL     71 - 140
VCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVTILANLVPFTLTLISFLLLICSLCKHLKKMQ    141 - 210
LHGKGSQDPSMKVHIKALQTVTSFLLLCAIYFLSIIMSVWSFESLENKPVFMFCEAIAFSYPSTHPFILI    211 - 280
WGNKKLKQTFLSVLWHVRYWVKGEKPSSS                                             281 - 309
//

Text Mined References (12)

PMID Year Title
23966204 2014 GWAS of human bitter taste perception identifies new loci and reveals additional complexity of bitter taste genetics.
23520545 2013 Bone marrow stromal and vascular smooth muscle cells have chemosensory capacity via bitter taste receptor expression.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
19628819 2009 Motile cilia of human airway epithelia are chemosensory.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
12584440 2002 Identification and characterization of human taste receptor genes belonging to the TAS2R family.
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379855 2002 The human TAS2R16 receptor mediates bitter taste in response to beta-glucopyranosides.
More...