Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MITFLPIIFSILVVVTFVIGNFANGFIALVNSTEWVKRQKISFADQIVTALAVSRVGLLWVLLLNWYSTV      1 - 70
LNPAFCSVELRTTAYNIWAVTGHFSNWPATSLSIFYLLKIANFSNLIFLRLKRRVKSVILVVLLGPLLFL     71 - 140
ACHLFVVNMNQIVWTKEYEGNMTWKIKLRRAMYLSDTTVTMLANLVPFTVTLISFLLLVCSLCKHLKKMQ    141 - 210
LHGKGSQDPSTKVHIKVLQTVISFFLLRAIYFVSVIISVWSFKNLENKPVFMFCQAIGFSCSSAHPFILI    211 - 280
WGNKKLKQTYLSVLWQMRY                                                       281 - 299
//

Text Mined References (7)

PMID Year Title
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379855 2002 The human TAS2R16 receptor mediates bitter taste in response to beta-glucopyranosides.
12139982 2002 Receptors for bitter and sweet taste.
11696554 2002 Molecular mechanisms of bitter and sweet taste transduction.