Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.53
PubTator Score 6.43

Knowledge Summary

Patent (2,111)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Balkan Nephropathy 6 4.314 2.2

Gene RIF (8)

AA Sequence

MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLWVLLLNWYSTV      1 - 70
LNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLHLKRRVKSVILVMLLGPLLFL     71 - 140
ACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVTMVANLVPFTLTLLSFMLLICSLCKHLKKMQ    141 - 210
LHGKGSQDPSTKVHIKALQTVISFLLLCAIYFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILI    211 - 280
WGNKKLKQTFLSVFWQMRYWVKGEKTSSP                                             281 - 309
//

Text Mined References (21)

PMID Year Title