Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.94
PubTator Score 6.43

Knowledge Summary

Patent (2,111)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Interstitial nephritis 6 3.501 1.8

Expression

Synonym

Accession P59537 P59546 Q645X4 T2R43
Symbols T2R43
T2R52

Gene

Gene RIF (8)

PMID Text
26391354 those with at least one sensitive TAS2R38 allele (AP or PP genotype) were more likely to report rejecting liquid medications than were those without a taster allele (AA genotype
26037485 Study demonstrates that the response profiles of the cat bitter receptors Tas2r38 and Tas2r43 are distinct from those of their orthologous human receptors
24647340 The effect of the TAS2R43 gene on coffee liking is mediated by caffeine and in particular by the H212R variant.
23050764 The mutational polymorphism TAS2R43 significantly affects susceptibility to BEN points to a potentially broad role for toxin responses in personal health risks.
22964302 Studies indicate that bitter-tasting compounds can have specific physiological effects in Bitter-tasting compounds can have specific physiological effects in type 2 taste receptors (T2Rs)-expressing cells.
22397221 Our results show that the expression rate of some of the T2R taste receptor genes was increased significantly in patients with phantogeusia.
17702579 hT2R43 gene allele makes people more sensitive to the bitterness of an artificial sweetener, saccharin; in addition, a closely related gene's (hT2R44's) allele also makes people more sensitive to the bitterness of saccharin.
15537898 hTAS2R43 and hTAS2R44 function as cognate bitter taste receptors and do not contribute to the sweet taste of saccharin and acesulfame K.

AA Sequence

MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLWVLLLNWYSTV      1 - 70
LNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLHLKRRVKSVILVMLLGPLLFL     71 - 140
ACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVTMVANLVPFTLTLLSFMLLICSLCKHLKKMQ    141 - 210
LHGKGSQDPSTKVHIKALQTVISFLLLCAIYFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILI    211 - 280
WGNKKLKQTFLSVFWQMRYWVKGEKTSSP                                             281 - 309
//

Text Mined References (21)

PMID Year Title
26391354 2015 Children's perceptions about medicines: individual differences and taste.
26037485 2015 A functional comparison of the domestic cat bitter receptors Tas2r38 and Tas2r43 with their human orthologs.
24647340 2014 Association analysis of bitter receptor genes in five isolated populations identifies a significant correlation between TAS2R43 variants and coffee liking.
23050764 2012 Association of a bitter taste receptor mutation with Balkan Endemic Nephropathy (BEN).
22964302 2012 Extraoral bitter taste receptors as mediators of off-target drug effects.
22397221 2012 Patients with phantogeusia show increased expression of T2R taste receptor genes in their tongues.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
19628819 2009 Motile cilia of human airway epithelia are chemosensory.
17702579 2007 Specific alleles of bitter receptor genes influence human sensitivity to the bitterness of aloin and saccharin.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
More...