Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 1.45

Knowledge Summary

Patent (1,284)

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-03

AA Sequence

MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQLVGTVHNFYYS      1 - 70
AQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHSTFLWLKWRFPGWVPWLLLGSVLI     71 - 140
SFIITLLFFWVNYPVYQEFLIRKFSGNMTYKWNTRIETYYFPSLKLVIWSIPFSVFLVSIMLLINSLRRH    141 - 210
TQRMQHNGHSLQDPSTQAHTRALKSLISFLILYALSFLSLIIDAAKFISMQNDFYWPWQIAVYLCISVHP    211 - 280
FILIFSNLKLRSVFSQLLLLARGFWVA                                               281 - 307
//

Text Mined References (12)

PMID Year Title