Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.11
PubTator Score 0.50

Knowledge Summary

Patent (1,921)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Gene RIF (1)

PMID Text
23333304 HIV-1 Vif downregulates the expression of taste receptor, type 2, member 40 (TAS2R40) in Vif-expression T cells

AA Sequence

MATVNTDATDKDISKFKVTFTLVVSGIECITGILGSGFITAIYGAEWARGKTLPTGDRIMLMLSFSRLLL      1 - 70
QIWMMLENIFSLLFRIVYNQNSVYILFKVITVFLNHSNLWFAAWLKVFYCLRIANFNHPLFFLMKRKIIV     71 - 140
LMPWLLRLSVLVSLSFSFPLSRDVFNVYVNSSIPIPSSNSTEKKYFSETNMVNLVFFYNMGIFVPLIMFI    141 - 210
LAATLLILSLKRHTLHMGSNATGSRDPSMKAHIGAIKATSYFLILYIFNAIALFLSTSNIFDTYSSWNIL    211 - 280
CKIIMAAYPAGHSVQLILGNPGLRRAWKRFQHQVPLYLKGQTL                               281 - 323
//

Text Mined References (10)

PMID Year Title
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379855 2002 The human TAS2R16 receptor mediates bitter taste in response to beta-glucopyranosides.
12139982 2002 Receptors for bitter and sweet taste.
11696554 2002 Molecular mechanisms of bitter and sweet taste transduction.