Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.11
PubTator Score 0.50

Knowledge Summary

Patent (1,921)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.1e-07

Gene RIF (1)

AA Sequence

MATVNTDATDKDISKFKVTFTLVVSGIECITGILGSGFITAIYGAEWARGKTLPTGDRIMLMLSFSRLLL      1 - 70
QIWMMLENIFSLLFRIVYNQNSVYILFKVITVFLNHSNLWFAAWLKVFYCLRIANFNHPLFFLMKRKIIV     71 - 140
LMPWLLRLSVLVSLSFSFPLSRDVFNVYVNSSIPIPSSNSTEKKYFSETNMVNLVFFYNMGIFVPLIMFI    141 - 210
LAATLLILSLKRHTLHMGSNATGSRDPSMKAHIGAIKATSYFLILYIFNAIALFLSTSNIFDTYSSWNIL    211 - 280
CKIIMAAYPAGHSVQLILGNPGLRRAWKRFQHQVPLYLKGQTL                               281 - 323
//

Text Mined References (13)

PMID Year Title