Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.06
PubTator Score 7.95

Knowledge Summary

Patent (1,136)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
medulloblastoma, large-cell 6,234

Gene RIF (4)

PMID Text
25273142 hTAS2R39 is the primary receptor for the bitterness of theaflavins
21942422 TAS2R14 and TAS2R39 were activated by isoflavones and other isoflavonoids.
21670512 Human bitter taste receptors hTAS2R8 and hTAS2R39 display differential functions to recognize bitter peptides.
21272567 these results suggest the participation of hTAS2R39 in the detection of catechins in humans.

AA Sequence

MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHAAEWVQNKAVS      1 - 70
TSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIA     71 - 140
NFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTYLSEINVVGLA    141 - 210
FFFNLGIVTPLIMFILTATLLILSLKRHTLHMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFI    211 - 280
YLSNMFDINSLWNNLCQIIMAAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL                281 - 338
//

Text Mined References (13)

PMID Year Title
25273142 2014 The human bitter taste receptor hTAS2R39 is the primary receptor for the bitterness of theaflavins.
21942422 2011 Soy isoflavones and other isoflavonoids activate the human bitter taste receptors hTAS2R14 and hTAS2R39.
21670512 2011 Human bitter taste receptors hTAS2R8 and hTAS2R39 with differential functions to recognize bitter peptides.
21272567 2011 Evaluation of the bitterness of green tea catechins by a cell-based assay with the human bitter taste receptor hTAS2R39.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...