Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.19
PubTator Score 7.95

Knowledge Summary

Patent (1,136)

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Gene RIF (4)

AA Sequence

MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHAAEWVQNKAVS      1 - 70
TSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIA     71 - 140
NFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTYLSEINVVGLA    141 - 210
FFFNLGIVTPLIMFILTATLLILSLKRHTLHMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFI    211 - 280
YLSNMFDINSLWNNLCQIIMAAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL                281 - 338
//

Text Mined References (13)

PMID Year Title