Property Summary

NCBI Gene PubMed Count 91
PubMed Score 165.01
PubTator Score 145.18

Knowledge Summary

Patent (35,289)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Alcoholism 45 0.0 0.0
THIOUREA TASTING 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8519 3.3e-11
medulloblastoma, large-cell 6241 1.1e-04
adult high grade glioma 3801 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Common cold 69 5.327 2.7
Nicotine dependence 54 3.313 1.7
Dental caries 164 3.214 1.6

Gene RIF (87)

AA Sequence

MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGL      1 - 70
LFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKI     71 - 140
SQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFL    141 - 210
VSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVM    211 - 280
VCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC                     281 - 333
//

Text Mined References (92)

PMID Year Title