Property Summary

NCBI Gene PubMed Count 77
Grant Count 11
R01 Count 6
Funding $1,733,908.67
PubMed Score 151.66
PubTator Score 145.18

Knowledge Summary

Patent (35,289)

Gene RIF (73)

PMID Text
26866366 T2R38 is expressed in distinct populations of enteroendocrine cells in the human colonic mucosa. It colocalized with CCK-, GLP1- or PYY-IR. There were more T2R38-positive cells in overweight/obese subjects.
26782143 phagocytes are activated via a rather specialized receptor that was not previously described on myeloid cells, the bitter taste receptor T2R38.
26562612 TAS2R38 genotype predicts surgical outcome in nonpolypoid chronic rhinosinusitis.
26552761 Our data suggest that the regulation of gingival innate immunity by T2R38 is genotype-dependent
26406243 Our analyses revealed also, besides simple associations, complex associations of bitterness sensitivity across TAS2R
26377569 dental plaque amount, lactobacilli count, age, and saliva buffer capacity, as well as TAS2R38 gene polymorphism, explained total of 87.8% of variations in DMFT scores.
26256902 The novel TAS2R38 AVV haplotype was associated with alcohol intake in Mexican-Mestizo population.
26037485 Study demonstrates that the response profiles of the cat bitter receptors Tas2r38 and Tas2r43 are distinct from those of their orthologous human receptors
25634331 A significant effect modification of the PROP(6-n-propylthiouracil)-taste intensity relationships by TAS2R38 diplotype was observed.
25573083 Expression and functional activity of the bitter taste receptors TAS2R1 and TAS2R38 in human keratinocytes
More...

AA Sequence

MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGL      1 - 70
LFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKI     71 - 140
SQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFL    141 - 210
VSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVM    211 - 280
VCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC                     281 - 333
//

Text Mined References (78)

PMID Year Title
26866366 2016 Expression of the Bitter Taste Receptor, T2R38, in Enteroendocrine Cells of the Colonic Mucosa of Overweight/Obese vs. Lean Subjects.
26782143 2016 Sensing developing biofilms: the bitter receptor T2R38 on myeloid cells.
26562612 2016 TAS2R38 genotype predicts surgical outcome in nonpolypoid chronic rhinosinusitis.
26552761 2015 Genotype-specific regulation of oral innate immunity by T2R38 taste receptor.
26406243 2015 Receptor Polymorphism and Genomic Structure Interact to Shape Bitter Taste Perception.
26377569 2016 Gene-environment Interactions in the Etiology of Dental Caries.
26256902 Association of a novel TAS2R38 haplotype with alcohol intake among Mexican-Mestizo population.
26037485 2015 A functional comparison of the domestic cat bitter receptors Tas2r38 and Tas2r43 with their human orthologs.
25634331 2014 The associations between 6-n-propylthiouracil (PROP) intensity and taste intensities differ by TAS2R38 haplotype.
25573083 2015 Expression and functional activity of the bitter taste receptors TAS2R1 and TAS2R38 in human keratinocytes.
More...