Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.17
PubTator Score 5.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
CREST syndrome 10 4.381 2.2
Telangiectasis 20 3.105 1.6

Expression

AA Sequence

MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQF      1 - 70
KEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKG     71 - 140
KGIAGREEMTDNTGYVSGYKGSGTYDKKTK                                            141 - 170
//

Text Mined References (8)

PMID Year Title
23436708 2013 Scanning of novel cancer/testis proteins by human testis proteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17105200 2006 Tubulin polymerization promoting proteins (TPPPs): members of a new family with distinct structures and functions.
15590652 2005 p25alpha Stimulates alpha-synuclein aggregation and is co-localized with aggregated alpha-synuclein in alpha-synucleinopathies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.