Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.03
PubTator Score 5.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
CREST Syndrome 16 4.427 2.2
Telangiectasis 36 3.121 1.6

Expression

Synonym

Accession P59282 Q2VYF3
Symbols P18
CT152
C14orf8
p25beta

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Protein-protein Interaction (1)

AA Sequence

MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQF      1 - 70
KEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKG     71 - 140
KGIAGREEMTDNTGYVSGYKGSGTYDKKTK                                            141 - 170
//

Text Mined References (8)

PMID Year Title