Property Summary

NCBI Gene PubMed Count 25
PubMed Score 9.85
PubTator Score 3.78

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P59190 G5EMR7 Q86TX7 Q8IW89
Symbols

Gene

 GO Function (1)

Gene RIF (11)

PMID Text
22427180 identified 4 Rab15 isoforms, Rab15CN, Rab15AN1, Rab15AN2 and Rab15AN3 in neuroblastoma cells and demonstrated that Rab15 isoform balance was significantly decreased in spheres of neuroblastoma cells; study suggests Rab15 alternative splicing may serve as a biomarker to discriminate tumor-initiating cells (TICs) from non-TICs in neuroblastoma
21491086 Rab15 expression correlates with retinoic acid-induced differentiation of neuroblastoma cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERY      1 - 70
QTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVGREQGQQLA     71 - 140
KEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELEGLRMRASNELALAELEEEEGKPEGPANSSKTC    141 - 210
WC                                                                        211 - 212
//

Text Mined References (25)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22899725 2012 A complete Rab screening reveals novel insights in Weibel-Palade body exocytosis.
22427180 2012 Rab15 alternative splicing is altered in spheres of neuroblastoma cells.
21491086 2011 Rab15 expression correlates with retinoic acid-induced differentiation of neuroblastoma cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
More...