Property Summary

NCBI Gene PubMed Count 130
PubMed Score 82.09
PubTator Score 42.90

Knowledge Summary

Patent

No data available

Gene RIF (148)

AA Sequence

MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYL      1 - 70
EMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQ     71 - 140
SCNHKEITSTKAE                                                             141 - 153
//

Text Mined References (130)

PMID Year Title