Property Summary

NCBI Gene PubMed Count 5
PubMed Score 11.15
PubTator Score 4.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P59095
Symbols

Gene

PDB

2MOU  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGD      1 - 70
RITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPS     71 - 140
SNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPS    141 - 210
RRGFHHNSHS                                                                211 - 220
//

Text Mined References (5)

PMID Year Title