Property Summary

NCBI Gene PubMed Count 5
PubMed Score 11.15
PubTator Score 4.47

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGD      1 - 70
RITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPS     71 - 140
SNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPS    141 - 210
RRGFHHNSHS                                                                211 - 220
//

Text Mined References (5)

PMID Year Title