Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.5e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.144 2.5e-05

Synonym

Accession P59091
Symbols C21orf93
NCRNA00315

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MDSLTERCRPQPLAALGPADAQLHGPAAAGGGVGPRVMLSSLCREHPWQGRCPPIPAHGKEVRQLRHLHR      1 - 70
TRPPDTHQDMARGPGLPHTHGLPARPSHVRHQTEPVQVASRWHVPSDGLCRPCHVHQLLHPPLVPALGA      71 - 139
//

Text Mined References (2)

PMID Year Title