Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

Synonym

Accession P59091
Symbols C21orf93
NCRNA00315

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20494980 The LINC00315/C21orf93 promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells.

AA Sequence

MDSLTERCRPQPLAALGPADAQLHGPAAAGGGVGPRVMLSSLCREHPWQGRCPPIPAHGKEVRQLRHLHR      1 - 70
TRPPDTHQDMARGPGLPHTHGLPARPSHVRHQTEPVQVASRWHVPSDGLCRPCHVHQLLHPPLVPALGA      71 - 139
//

Text Mined References (2)

PMID Year Title
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
12036297 2002 Nineteen additional unpredicted transcripts from human chromosome 21.