Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 7.3e-05
Astrocytoma, Pilocytic -1.100 3.3e-05
atypical teratoid / rhabdoid tumor -1.100 1.9e-03
ependymoma -1.100 3.6e-05
glioblastoma -1.100 8.5e-05
intraductal papillary-mucinous neoplasm ... 1.100 2.6e-02
medulloblastoma, large-cell -1.700 1.7e-03
ovarian cancer -1.700 1.1e-07
Pick disease -1.400 6.9e-03

Synonym

Accession P59089
Symbols

 Compartment GO Term (0)

AA Sequence

MTPARPPRFPDDGSWRAFLRQRPQATERRPRRERMFVKLLLEGKLPPTLNTPVSRHRQGSGHKPASPFYS      1 - 70
QNRGLRTFFNDFRATECTGRPRLCFHSLRCGAFSPGAPCWGRFNRRPCLPPTVLRKDRPSLPQERPGWRS     71 - 140
PGVGGSSELALSPPGLVSPQSGPWP                                                 141 - 165
//

Text Mined References (1)

PMID Year Title