Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P59089
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTPARPPRFPDDGSWRAFLRQRPQATERRPRRERMFVKLLLEGKLPPTLNTPVSRHRQGSGHKPASPFYS      1 - 70
QNRGLRTFFNDFRATECTGRPRLCFHSLRCGAFSPGAPCWGRFNRRPCLPPTVLRKDRPSLPQERPGWRS     71 - 140
PGVGGSSELALSPPGLVSPQSGPWP                                                 141 - 165
//

Text Mined References (1)

PMID Year Title
12036297 2002 Nineteen additional unpredicted transcripts from human chromosome 21.