Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P59074 Q8NFA9
Symbols

Gene

PANTHER Protein Class (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MLSKKQEFLEKKIEQRHGTKNKPAALQALKRKKRYEKQLAQIDGTLSTIEFQQQALENANTNTEVLKNMG      1 - 70
SAAKAKKAAHDNMDIDKVDELMQDIADQQELGEEISTAISKPVGFGEKSDEDELMAELEELEQEEPDKNL     71 - 140
LEVSGPETVPLPNVPSIALPSKPAKKRKTTT                                           141 - 171
//

Text Mined References (2)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
12508121 2003 The DNA sequence and analysis of human chromosome 14.