Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P59074 Q8NFA9
Symbols

Gene

PANTHER Protein Class (1)

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MLSKKQEFLEKKIEQRHGTKNKPAALQALKRKKRYEKQLAQIDGTLSTIEFQQQALENANTNTEVLKNMG      1 - 70
SAAKAKKAAHDNMDIDKVDELMQDIADQQELGEEISTAISKPVGFGEKSDEDELMAELEELEQEEPDKNL     71 - 140
LEVSGPETVPLPNVPSIALPSKPAKKRKTTT                                           141 - 171
//

Text Mined References (2)

PMID Year Title