Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.6e-27
lung adenocarcinoma 2716 1.2e-04

Expression

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MRRLRHREVRGPVLGHTATGGPQNGTSGCTTAPQQRPPPGTQGMLEQYLNRGGQKSHGLCWLLCFVSQGQ      1 - 70
NQDVISAELWCRIHVQAHWGCWQNSAVWGCRNEVLVSLLAVGQGLPSASGGRLPSLVHGPSHPDSQHPRE     71 - 140
VPLAL                                                                     141 - 145
//

Text Mined References (7)

PMID Year Title