Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung adenocarcinoma 2,713
psoriasis 6,685

Synonym

Accession P59052 Q0VDC1 Q547X5
Symbols C21orf88

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20494980 The C21orf88 promoter is activated by Trichostatin A (TSA) treatment and by serum depletion according to promoter reporter assays in HEK 293 cells.

AA Sequence

MRRLRHREVRGPVLGHTATGGPQNGTSGCTTAPQQRPPPGTQGMLEQYLNRGGQKSHGLCWLLCFVSQGQ      1 - 70
NQDVISAELWCRIHVQAHWGCWQNSAVWGCRNEVLVSLLAVGQGLPSASGGRLPSLVHGPSHPDSQHPRE     71 - 140
VPLAL                                                                     141 - 145
//

Text Mined References (7)

PMID Year Title
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036297 2002 Nineteen additional unpredicted transcripts from human chromosome 21.
11181995 2001 The sequence of the human genome.
10830953 2000 The DNA sequence of human chromosome 21.