Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P59051 A1L3W1 D3DSH8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLGWIQPSRQPQLRAAPPTRTPSAKRCILCNFLPGCWLVGDVAGSRQPSAPQTLRQRQHTRPPPQERGSG      1 - 70
RRSPLREARRANPHFKSFPVLEARGLPCGARRTGPRRPVREMTLPSDPERATLPNPRLGAPAVPRRGPRS     71 - 140
HGGRR                                                                     141 - 145
//

Text Mined References (5)

PMID Year Title
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036297 2002 Nineteen additional unpredicted transcripts from human chromosome 21.
10830953 2000 The DNA sequence of human chromosome 21.