Property Summary

NCBI Gene PubMed Count 33
Grant Count 101
R01 Count 51
Funding $13,083,858.46
PubMed Score 232.46
PubTator Score 53.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.277 0.000
tuberculosis 1.100 0.012

Synonym

Accession P59046 A8MTQ2 B3KTE7 Q8NEU4 Q9BY26
Symbols RNO
PAN6
RNO2
FCAS2
NALP12
PYPAF7
CLR19.3

Gene

PDB

2L6A   4XHS  

 GO Component (1)

Gene RIF (24)

PMID Text
26763980 NLRX1, NLRP12 and NLRC3 negatively modulate the host immune response following virus exposure. (Review)
26329693 This process involved the upregulation of NLRP12.
26122175 Variants of NLRP12 were associated with common variable immunodeficiency.
25249449 The genetics, expression and roles of NLRP12 in inflammatory signaling, host defense, and carcinogenesis are reviewed. Review.
25064839 This study suggested that NLRP12 mutations might account for a small fraction of common variable immunodeficiency patients with severe auto-inflammatory complications.
24453977 NLRP12/NLRP3-dependent activation of caspase-1 is likely to be a key event in mediating systemic production of IL-1beta and hypersensitivity to secondary bacterial infection during malaria.
24338634 We will focus on NLRP6 and NLRP12.
24064030 Letter: NLRP12 mutations associated with familial cold autoinflammatory syndrome 2 in Italian patients.
21978668 The authors report the first in vitro confirmed non-homotypic interaction between NLRP12 pyrin domain and the pro-apoptotic protein Fas-associated factor 1 (FAF-1), which links the innate immune system to apoptotic signaling.
21538323 NLRP12 missense mutation in periodic fever syndromes; study provides evidence of deleterious effect of an NLRP12 missense mutation; this newly identified molecular defect emphasizes the crucial role played by NLRP12 in autoinflammation
More...

AA Sequence

MLRTAGRDGLCRLSTYLEELEAVELKKFKLYLGTATELGEGKIPWGSMEKAGPLEMAQLLITHFGPEEAW      1 - 70
RLALSTFERINRKDLWERGQREDLVRDTPPGGPSSLGNQSTCLLEVSLVTPRKDPQETYRDYVRRKFRLM     71 - 140
EDRNARLGECVNLSHRYTRLLLVKEHSNPMQVQQQLLDTGRGHARTVGHQASPIKIETLFEPDEERPEPP    141 - 210
RTVVMQGAAGIGKSMLAHKVMLDWADGKLFQGRFDYLFYINCREMNQSATECSMQDLIFSCWPEPSAPLQ    211 - 280
ELIRVPERLLFIIDGFDELKPSFHDPQGPWCLCWEEKRPTELLLNSLIRKKLLPELSLLITTRPTALEKL    281 - 350
HRLLEHPRHVEILGFSEAERKEYFYKYFHNAEQAGQVFNYVRDNEPLFTMCFVPLVCWVVCTCLQQQLEG    351 - 420
GGLLRQTSRTTTAVYMLYLLSLMQPKPGAPRLQPPPNQRGLCSLAADGLWNQKILFEEQDLRKHGLDGED    421 - 490
VSAFLNMNIFQKDINCERYYSFIHLSFQEFFAAMYYILDEGEGGAGPDQDVTRLLTEYAFSERSFLALTS    491 - 560
RFLFGLLNEETRSHLEKSLCWKVSPHIKMDLLQWIQSKAQSDGSTLQQGSLEFFSCLYEIQEEEFIQQAL    561 - 630
SHFQVIVVSNIASKMEHMVSSFCLKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDA    631 - 700
YSEHLAAALCTNPNLIELSLYRNALGSRGVKLLCQGLRHPNCKLQNLRLKRCRISSSACEDLSAALIANK    701 - 770
NLTRMDLSGNGVGFPGMMLLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNPHLVELDLTGNALE    771 - 840
DLGLRLLCQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRH    841 - 910
PTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSC    911 - 980
GLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAAL    981 - 1050
RVTKPYLDIGC                                                              1051 - 1061
//

Text Mined References (34)

PMID Year Title
26763980 2016 Beyond the inflammasome: regulatory NOD-like receptor modulation of the host immune response following virus exposure.
26329693 2015 Desflurane preconditioning protects human umbilical vein endothelial cells against anoxia/reoxygenation by upregulating NLRP12 and inhibiting non-canonical nuclear factor-?B signaling.
26122175 2015 Application of whole genome and RNA sequencing to investigate the genomic landscape of common variable immunodeficiency disorders.
25249449 2014 The multifaceted nature of NLRP12.
25064839 2014 Novel NLRP12 mutations associated with intestinal amyloidosis in a patient diagnosed with common variable immunodeficiency.
24453977 2014 Malaria-induced NLRP12/NLRP3-dependent caspase-1 activation mediates inflammation and hypersensitivity to bacterial superinfection.
24338634 2014 Role of Nlrp6 and Nlrp12 in the maintenance of intestinal homeostasis.
24064030 Rare NLRP12 variants associated with the NLRP12-autoinflammatory disorder phenotype: an Italian case series.
22427013 2012 The rhapsody of NLRPs: master players of inflammation...and a lot more.
21978668 2011 The NLRP12 pyrin domain: structure, dynamics, and functional insights.
More...