Property Summary

NCBI Gene PubMed Count 17
Grant Count 41
R01 Count 27
Funding $4,316,232.42
PubMed Score 762.35
PubTator Score 60.39

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
24338634 We will focus on NLRP6 and NLRP12.
24147025 Our results revealed an association between NLRP6/AVR and ADM loci with male essential hypertension, suggesting the existence of sex-specific NLRP6/AVR and ADM variants affecting male susceptibility to essential hypertension.
23811097 NLRP6 is a newly characterized member of this family that inhibits NF-kappaB and MAP-kinase dependent immune signaling to hamper anti-microbial defense.
22503597 A. actinomycetemcomitans enhances NLRP3 and reduces NLRP6 inflammasome expression.
20923861 Studies identify AVR/NAVR as key receptors involved in blood pressure regulation and sex-specific modulation of renal water homeostasis, cognitive function, and anxiety-like behavior.
20403135 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18413781 AVR is distinct from Nalp6/PYPAF5 based on different mRNA and protein sizes, subcellular localization, and tissue-specific expression patterns.
12387869 PYPAF5 functions in immune cells to coordinate the transduction of pro-inflammatory signals to the activation of NF-kappaB and pro-caspase-1
11984003 The dual AngII/AVP receptor gene N119S/C163R variant exhibits sodium-induced dysfunction and cosegregates with salt-sensitive hypertension in the Dahl salt-sensitive hypertensive rat model.
More...

AA Sequence

MDQPEAPCSSTGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERADAVDLAEQLAQ      1 - 70
FYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSGTLLSVSEYKKKYREHVLQLHARVKERNARS     71 - 140
VKITKRFTKLLIAPESAAPEEAMGPAEEPEPGRARRSDTHTFNRLFRRDEEGRRPLTVVLQGPAGIGKTM    141 - 210
AAKKILYDWAAGKLYQGQVDFAFFMPCGELLERPGTRSLADLILDQCPDRGAPVPQMLAQPQRLLFILDG    211 - 280
ADELPALGGPEAAPCTDPFEAASGARVLGGLLSKALLPTALLLVTTRAAAPGRLQGRLCSPQCAEVRGFS    281 - 350
DKDKKKYFYKYFRDERRAERAYRFVKENETLFALCFVPFVCWIVCTVLRQQLELGRDLSRTSKTTTSVYL    351 - 420
LFITSVLSSAPVADGPRLQGDLRNLCRLAREGVLGRRAQFAEKELEQLELRGSKVQTLFLSKKELPGVLE    421 - 490
TEVTYQFIDQSFQEFLAALSYLLEDGGVPRTAAGGVGTLLRGDAQPHSHLVLTTRFLFGLLSAERMRDIE    491 - 560
RHFGCMVSERVKQEALRWVQGQGQGCPGVAPEVTEGAKGLEDTEEPEEEEEGEEPNYPLELLYCLYETQE    561 - 630
DAFVRQALCRFPELALQRVRFCRMDVAVLSYCVRCCPAGQALRLISCRLVAAQEKKKKSLGKRLQASLGG    631 - 700
GSSSQGTTKQLPASLLHPLFQAMTDPLCHLSSLTLSHCKLPDAVCRDLSEALRAAPALTELGLLHNRLSE    701 - 770
AGLRMLSEGLAWPQCRVQTVRVQLPDPQRGLQYLVGMLRQSPALTTLDLSGCQLPAPMVTYLCAVLQHQG    771 - 840
CGLQTLSLASVELSEQSLQELQAVKRAKPDLVITHPALDGHPQPPKELISTF                      841 - 892
//

Text Mined References (22)

PMID Year Title
24338634 2014 Role of Nlrp6 and Nlrp12 in the maintenance of intestinal homeostasis.
24147025 2013 Sex-specific effects of NLRP6/AVR and ADM loci on susceptibility to essential hypertension in a Sardinian population.
23811097 NLRP6 in infection and inflammation.
23470617 2013 Stress-induced corticotropin-releasing hormone-mediated NLRP6 inflammasome inhibition and transmissible enteritis in mice.
22503597 2012 Aggregatibacter actinomycetemcomitans targets NLRP3 and NLRP6 inflammasome expression in human mononuclear leukocytes.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21593405 2011 Nod-like receptor pyrin domain-containing protein 6 (NLRP6) controls epithelial self-renewal and colorectal carcinogenesis upon injury.
21088234 2011 Developmental control of the Nlrp6 inflammasome and a substrate, IL-18, in mammalian intestine.
20923861 2011 AVR/NAVR deficiency lowers blood pressure and differentially affects urinary concentrating ability, cognition, and anxiety-like behavior in male and female mice.
20403135 2010 The genetics of NOD-like receptors in Crohn's disease.
More...