Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P59037 Q3KNU0
Symbols C21orf84
NCRNA00313
CH507-42P11.5

Gene

 Compartment GO Term (0)

AA Sequence

MTTLSKSKQPSAAGNLDEQTPGECFCRSCFVTSSEVWKRWKHLDPACAADPWEAPTPRIEKPDGKECLGR      1 - 70
TSCPRLA                                                                    71 - 77
//

Text Mined References (5)

PMID Year Title
26178480 2015 Differentially expressed protein-coding genes and long noncoding RNA in early-stage lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036297 2002 Nineteen additional unpredicted transcripts from human chromosome 21.
10830953 2000 The DNA sequence of human chromosome 21.