Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 416 6.1e-07

AA Sequence

MRQGCKFRGSSQKIRWSRSPPSSLLHTLRPRLLSAEITLQTNLPLQSPCCRLCFLRGTQAKTLK            1 - 64
//

Text Mined References (6)

PMID Year Title