Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
posterior fossa group B ependymoma 1,530

Synonym

Accession P59036 Q52LY1
Symbols C21orf82
NCRNA00310

Gene

 Compartment GO Term (0)

AA Sequence

MRQGCKFRGSSQKIRWSRSPPSSLLHTLRPRLLSAEITLQTNLPLQSPCCRLCFLRGTQAKTLK            1 - 64
//

Text Mined References (6)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036297 2002 Nineteen additional unpredicted transcripts from human chromosome 21.
11181995 2001 The sequence of the human genome.
10830953 2000 The DNA sequence of human chromosome 21.