Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
R01 Count 5
Funding $542,183.66
PubMed Score 19.34
PubTator Score 7.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cysticercosis 12 3.471 1.7

Expression

Synonym

Accession P59025
Symbols Z3CXXC1

Gene

Gene RIF (2)

PMID Text
22570474 Receptor-transporting protein 1 short (RTP1S) mediates translocation and activation of odorant receptors by acting through multiple steps
16720576 RTP and REEP gene expression in human circumvallate papillae and testis, both of which are sites of taste receptor gene expression.

AA Sequence

MRIFRPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPN      1 - 70
LKHNVLSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARL     71 - 140
DESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASRQDNRRHRGEFCEACQEGIVHWKPSEKLLEE    141 - 210
EATTYTFSRAPSPTKSQDQTGSGWNFCSIPWCLFWATVLLLIIYLQFSFRSSV                     211 - 263
//

Text Mined References (8)

PMID Year Title
22570474 2012 Receptor-transporting protein 1 short (RTP1S) mediates translocation and activation of odorant receptors by acting through multiple steps.
17387175 2007 Synergism of accessory factors in functional expression of mammalian odorant receptors.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16271481 2005 Inherited ACTH insensitivity illuminates the mechanisms of ACTH action.
15550249 2004 RTP family members induce functional expression of mammalian odorant receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.