Property Summary

NCBI Gene PubMed Count 23
PubMed Score 11.60
PubTator Score 2.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Breast cancer 3.600 2.4e-02
breast carcinoma 1.700 8.0e-26
cutaneous lupus erythematosus 1.100 5.3e-03
cystic fibrosis 1.671 1.1e-06
ductal carcinoma in situ 2.700 2.3e-03
gastric cancer -1.100 8.4e-03
glioblastoma 1.600 3.1e-02
intraductal papillary-mucinous adenoma (... 1.900 4.5e-04
intraductal papillary-mucinous carcinoma... 1.900 8.2e-03
intraductal papillary-mucinous neoplasm ... 2.800 6.2e-04
invasive ductal carcinoma 3.900 3.0e-03
lung adenocarcinoma 1.100 6.0e-11
lung cancer 2.300 9.2e-04
lung carcinoma 1.300 2.2e-15
Multiple myeloma 1.295 1.3e-02
non-small cell lung cancer 1.731 6.2e-17
ovarian cancer 1.500 6.1e-06
pancreatic cancer 1.700 1.4e-05
psoriasis -1.700 6.5e-04

Gene RIF (5)

AA Sequence

MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (35)

PMID Year Title