Property Summary

NCBI Gene PubMed Count 104
Grant Count 86
R01 Count 49
Funding $4,822,551.82
PubMed Score 85.70
PubTator Score 74.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.971 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.100 0.003
medulloblastoma, large-cell 1.300 0.000
adult high grade glioma 1.100 0.001
ovarian cancer 1.500 0.000

Synonym

Accession P58753 B3KW65 Q56UH9 Q56UI0 Q8N5E5 TIR domain-containing adapter protein
Symbols Mal
wyatt
BACTS1
MyD88-2

Gene

PDB

2Y92   3UB2   3UB3   3UB4   4FZ5   4LQD  

Gene RIF (85)

PMID Text
26614847 Chances of malaria caused by Plasmodium falciparum were low in CC genotype carriers in comparison to other genotypes
26564000 TIRAP polymorphisms are associated with progression and survival of patients with symptomatic myeloma.
25182168 The TIRAP S180L and TLR9 -1486 T>C polymorphism showed no association with systemic lupus erythematosus (SLE) risk, but they influenced SLE phenotype.
25066393 Evaluated the possible association between TIRAP rs1893352 and rs8177374 (S180L) gene polymorphisms and pulmonary tuberculosis in a sample of Iranian population.
25003251 This present meta-analysis suggests TIRAP C539T polymorphism is significantly correlated with reduced risk of TB infection, with stronger effect in European.
24330528 CCL2rs2530797A/A and TIRAPrs8177376A/A were associated to an increase susceptibility to Chagas disease cardiomyopathy.
24275656 Data indicate that TcpB (NP_540591) may mimic the function of TIRAP through their similar TIR domain structures.
24067789 TIRAP rs81777374 is associated with resistance to pulmonary tuberculosis.
24064014 TIRAP S180L polymorphism is not increased in Behcet's disease patients in Italian or Turkish populations.
23802631 PSP has an immunoregulatory effect through regulation of the TLR4-TIRAP/MAL-MyD88 signaling pathway.
More...

AA Sequence

MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLP      1 - 70
PTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSS     71 - 140
HCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVK    141 - 210
EAVMRYLQTLS                                                               211 - 221
//

Text Mined References (107)

PMID Year Title
26614847 2015 Role of S180L polymorphism in etiology of malaria caused by Plasmodium falciparum in a small group of Pakistani population.
26564000 2016 TLR4/TIRAP polymorphisms are associated with progression and survival of patients with symptomatic myeloma.
25182168 2015 Association of TLR4 (D299G, T399I), TLR9 -1486T>C, TIRAP S180L and TNF-? promoter (-1031, -863, -857) polymorphisms with risk for systemic lupus erythematosus among South Indians.
25066393 2014 TIRAP rs8177374 gene polymorphism increased the risk of pulmonary tuberculosis in Zahedan, southeast Iran.
25003251 2014 TIRAP C539T polymorphism contributes to tuberculosis susceptibility: evidence from a meta-analysis.
24330528 2013 Genetic susceptibility to Chagas disease cardiomyopathy: involvement of several genes of the innate immunity and chemokine-dependent migration pathways.
24275656 2014 Crystal structures of the Toll/Interleukin-1 receptor (TIR) domains from the Brucella protein TcpB and host adaptor TIRAP reveal mechanisms of molecular mimicry.
24067789 2013 The MyD88 rs6853 and TIRAP rs8177374 polymorphic sites are associated with resistance to human pulmonary tuberculosis.
24064014 TIR-domain-containing adaptor protein gene TIRAP S180L polymorphism is not increased in Behçet's disease patients in two ethnic cohorts.
23802631 2013 A study on the immunomodulation of polysaccharopeptide through the TLR4-TIRAP/MAL-MyD88 signaling pathway in PBMCs from breast cancer patients.
More...