Property Summary

NCBI Gene PubMed Count 107
PubMed Score 90.90
PubTator Score 74.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.100 1.1e-03
atypical teratoid / rhabdoid tumor 1.200 1.9e-05
glioblastoma 1.100 2.8e-03
medulloblastoma, large-cell 1.300 2.8e-05
osteosarcoma -1.971 4.2e-07
ovarian cancer 1.500 2.0e-11

Protein-protein Interaction (5)

Gene RIF (89)

AA Sequence

MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLP      1 - 70
PTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSS     71 - 140
HCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVK    141 - 210
EAVMRYLQTLS                                                               211 - 221
//

Text Mined References (110)

PMID Year Title