Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.84
PubTator Score 197.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.20164694541896E-10
Breast cancer 3099 1.68003385777478E-8
group 4 medulloblastoma 1875 4.08883688725869E-7
medulloblastoma, large-cell 6234 8.86915358729492E-7
urothelial carcinoma 318 4.48270291441097E-6
nasopharyngeal carcinoma 1056 1.70655831540177E-4
osteosarcoma 7933 3.0702980924684E-4
gastric cancer 436 4.3001372585922E-4
atypical teratoid / rhabdoid tumor 4369 5.09151327338665E-4
invasive ductal carcinoma 2950 0.00206653693461138
ovarian cancer 8492 0.00218396225561404
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0136654013382625
astrocytic glioma 2241 0.0342899769349141
oligodendroglioma 2849 0.0348091681090721
Disease Target Count Z-score Confidence
Down syndrome 548 3.369 1.7

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.100 0.000
urothelial carcinoma -2.200 0.000
astrocytic glioma -1.200 0.034
oligodendroglioma -1.300 0.035
osteosarcoma -2.557 0.000
group 4 medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -1.600 0.001
medulloblastoma, large-cell -2.800 0.000
non-small cell lung cancer -1.356 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.014
nasopharyngeal carcinoma -1.400 0.000
Breast cancer -2.100 0.000
invasive ductal carcinoma -1.600 0.002
ovarian cancer 2.000 0.002

Synonym

Accession P58658 A6ND58 Q8IXZ0
Symbols B18
B19
SUE21
PRED34
FAM176C
C21orf63
C21orf64

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans EggNOG Inparanoid

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19470522 C21orf63 is a heparin-binding protein; in glycan microassay, the product of C21orf63 binds with heparin and heparan sulfate; real-time polymerase chain reaction and tissue immunostaining imply that C21orf63 is expressed on epithelia of various tissues
17672918 validated occurrence of an unusual TG 3' splice site in intron 3

AA Sequence

MLLPGRARQPPTPQPVQHPGLRRQVEPPGQLLRLFYCTVLVCSKEISALTDFSGYLTKLLQNHTTYACDG      1 - 70
DYLNLQCPRHSTISVQSAFYGQDYQMCSSQKPASQREDSLTCVAATTFQKVLDECQNQRACHLLVNSRVF     71 - 140
GPDLCPGSSKYLLVSFKCQPNELKNKTVCEDQELKLHCHESKFLNIYSATYGRRTQERDICSSKAERLPP    141 - 210
FDCLSYSALQVLSRRCYGKQRCKIIVNNHHFGSPCLPGVKKYLTVTYACVPKNILTAIDPAIANLKPSLK    211 - 280
QKDGEYGINFDPSGSKVLRKDGILVSNSLAAFAYIRAHPERAALLFVSSVCIGLALTLCALVIRESCAKD    281 - 350
FRDLQLGREQLVPGSDKVEEDSEDEEEEEDPSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQII    351 - 420
QEIWMNSGLDTSLPRNMGQFY                                                     421 - 441
//

Text Mined References (10)

PMID Year Title
24040182 2013 The expression pattern of EVA1C, a novel Slit receptor, is consistent with an axon guidance role in the mouse nervous system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19470522 2009 Human C21orf63 is a heparin-binding protein.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707072 2001 From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map.
10830953 2000 The DNA sequence of human chromosome 21.