Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.84
PubTator Score 197.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.100 0.000
urothelial carcinoma -2.200 0.000
astrocytic glioma -1.200 0.034
oligodendroglioma -1.300 0.035
osteosarcoma -2.557 0.000
group 4 medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -1.600 0.001
medulloblastoma, large-cell -2.800 0.000
non-small cell lung cancer -1.356 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.014
nasopharyngeal carcinoma -1.400 0.000
Breast cancer -2.100 0.000
invasive ductal carcinoma -1.600 0.002
ovarian cancer 2.000 0.002

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19470522 C21orf63 is a heparin-binding protein; in glycan microassay, the product of C21orf63 binds with heparin and heparan sulfate; real-time polymerase chain reaction and tissue immunostaining imply that C21orf63 is expressed on epithelia of various tissues
17672918 validated occurrence of an unusual TG 3' splice site in intron 3

AA Sequence

MLLPGRARQPPTPQPVQHPGLRRQVEPPGQLLRLFYCTVLVCSKEISALTDFSGYLTKLLQNHTTYACDG      1 - 70
DYLNLQCPRHSTISVQSAFYGQDYQMCSSQKPASQREDSLTCVAATTFQKVLDECQNQRACHLLVNSRVF     71 - 140
GPDLCPGSSKYLLVSFKCQPNELKNKTVCEDQELKLHCHESKFLNIYSATYGRRTQERDICSSKAERLPP    141 - 210
FDCLSYSALQVLSRRCYGKQRCKIIVNNHHFGSPCLPGVKKYLTVTYACVPKNILTAIDPAIANLKPSLK    211 - 280
QKDGEYGINFDPSGSKVLRKDGILVSNSLAAFAYIRAHPERAALLFVSSVCIGLALTLCALVIRESCAKD    281 - 350
FRDLQLGREQLVPGSDKVEEDSEDEEEEEDPSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQII    351 - 420
QEIWMNSGLDTSLPRNMGQFY                                                     421 - 441
//

Text Mined References (10)

PMID Year Title
24040182 2013 The expression pattern of EVA1C, a novel Slit receptor, is consistent with an axon guidance role in the mouse nervous system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19470522 2009 Human C21orf63 is a heparin-binding protein.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707072 2001 From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map.
10830953 2000 The DNA sequence of human chromosome 21.