Property Summary

NCBI Gene PubMed Count 7
PubMed Score 23.24
PubTator Score 2.48

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.200 2.3e-02
atypical teratoid / rhabdoid tumor 1.100 1.1e-04
ependymoma 1.500 2.8e-02
group 4 medulloblastoma 1.600 1.5e-04
medulloblastoma, large-cell 1.300 4.7e-04
oligodendroglioma 1.600 1.5e-02

Gene RIF (2)

AA Sequence

MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHE      1 - 70
HLKAGEFPQPDFPDDYNLGDIFLGVEYIFHQCKENEDYNDVLTVTATHGLCHLLGFTHGTEAEWQQMFQK     71 - 140
EKAVLDELGRRTGTRLQPLTRGLFGGS                                               141 - 167
//

Text Mined References (8)

PMID Year Title