Property Summary

NCBI Gene PubMed Count 6
Grant Count 6
R01 Count 6
Funding $2,560,981
PubMed Score 26.41
PubTator Score 2.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.200 0.023
ependymoma 1.500 0.028
oligodendroglioma 1.600 0.015
atypical teratoid / rhabdoid tumor 1.100 0.000
group 4 medulloblastoma 1.600 0.000
medulloblastoma, large-cell 1.300 0.000

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHE      1 - 70
HLKAGEFPQPDFPDDYNLGDIFLGVEYIFHQCKENEDYNDVLTVTATHGLCHLLGFTHGTEAEWQQMFQK     71 - 140
EKAVLDELGRRTGTRLQPLTRGLFGGS                                               141 - 167
//

Text Mined References (7)

PMID Year Title
22042635 2012 Antibody-based protein profiling of the human chromosome 21.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16341674 2005 Transcriptome analysis of human gastric cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707072 2001 From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map.
10830953 2000 The DNA sequence of human chromosome 21.