Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MEVVLIFVYSLLVPVVLASAAKEKEIDPFHYNYQTLRIGGLVFDVVLFLVPSCHLLSHRCKCSFNQKPQD      1 - 70
PGDKEAQVENFITANAKEPQKAKN                                                   71 - 94
//

Text Mined References (1)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.