Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.06
PubTator Score 3.35

Knowledge Summary

Patent (276)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.000 7.3e-06
astrocytic glioma -2.600 1.1e-03
Astrocytoma, Pilocytic -1.800 6.5e-05
atypical teratoid / rhabdoid tumor -3.700 4.7e-10
ependymoma -2.800 2.1e-02
glioblastoma -2.700 4.2e-06
group 3 medulloblastoma -4.100 1.6e-05
medulloblastoma, large-cell -3.600 4.0e-05
oligodendroglioma -1.500 3.7e-02
Pick disease -2.100 2.6e-03
primitive neuroectodermal tumor -2.000 2.2e-02
severe Alzheimer's disease -1.040 4.9e-02

Gene RIF (3)

AA Sequence

MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSEL      1 - 70
PSSAPGGGGV                                                                 71 - 80
//

Text Mined References (9)

PMID Year Title