Property Summary

NCBI Gene PubMed Count 24
PubMed Score 64.12
PubTator Score 35.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Motor neuritis 3 4.398 2.2

Expression

Synonym

Accession P58546
Symbols V-1
GCDP

Gene

PDB

3AAA  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (3)

PMID Text
26274321 T allele of rs17168525 in the 3'-UTR of myotrophin influence the level of myotrophin protein by interfering with let-7 binding.The T allele of MTPN rs17168525 is not associated with the left ventricular hypertrophy risk in essential hypertension patients.
16982933 a novel internal ribosome entry site-mediated mechanism may be responsible for the translation of unconventional self-Ag MPD6 in response to IFN-alpha stimulation.
11971907 myotrophin/V-1 is a regulatory protein for modulating the levels of activated NFkappaB dimers.

AA Sequence

MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHIT      1 - 70
PLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ                           71 - 118
//

Text Mined References (28)

PMID Year Title
26274321 2015 The Human Myotrophin Variant Attenuates MicroRNA-Let-7 Binding Ability but Not Risk of Left Ventricular Hypertrophy in Human Essential Hypertension.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20625546 2010 Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16982933 2006 An unconventional antigen translated by a novel internal ribosome entry site elicits antitumor humoral immune reactions.
16895918 2006 Binding of myotrophin/V-1 to actin-capping protein: implications for how capping protein binds to the filament barbed end.
16381901 2006 The LIFEdb database in 2006.
More...