Property Summary

NCBI Gene PubMed Count 24
Grant Count 30
R01 Count 17
Funding $6,432,972.42
PubMed Score 64.12
PubTator Score 35.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Motor neuritis 3 4.398 2.2

Expression

Gene RIF (3)

PMID Text
26274321 T allele of rs17168525 in the 3'-UTR of myotrophin influence the level of myotrophin protein by interfering with let-7 binding.The T allele of MTPN rs17168525 is not associated with the left ventricular hypertrophy risk in essential hypertension patients.
16982933 a novel internal ribosome entry site-mediated mechanism may be responsible for the translation of unconventional self-Ag MPD6 in response to IFN-alpha stimulation.
11971907 myotrophin/V-1 is a regulatory protein for modulating the levels of activated NFkappaB dimers.

AA Sequence

MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHIT      1 - 70
PLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ                           71 - 118
//

Text Mined References (28)

PMID Year Title
26274321 2015 The Human Myotrophin Variant Attenuates MicroRNA-Let-7 Binding Ability but Not Risk of Left Ventricular Hypertrophy in Human Essential Hypertension.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20625546 2010 Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16982933 2006 An unconventional antigen translated by a novel internal ribosome entry site elicits antitumor humoral immune reactions.
16895918 2006 Binding of myotrophin/V-1 to actin-capping protein: implications for how capping protein binds to the filament barbed end.
16381901 2006 The LIFEdb database in 2006.
More...