Property Summary

NCBI Gene PubMed Count 25
PubMed Score 66.66
PubTator Score 35.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Motor neuritis 2 4.309 2.2

Expression

Synonym

Accession P58546
Symbols V-1
GCDP

Gene

PDB

3AAA  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHIT      1 - 70
PLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ                           71 - 118
//

Text Mined References (29)

PMID Year Title