Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Down syndrome 548 3.229 1.6

Synonym

Accession P58513
Symbols C21orf42
NCRNA00158

Gene

 Compartment GO Term (0)

AA Sequence

MFSLFIENRYLHLLHALSLVTDVSRIQSHFGTLPRIKDEHRSHQESKYHFGGHVQIRFGSDQDWRQGHQS      1 - 70
FLLKTGPCKKR                                                                71 - 81
//

Text Mined References (2)

PMID Year Title
11707072 2001 From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map.
10830953 2000 The DNA sequence of human chromosome 21.