Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

AA Sequence

MGWDCRRTTVENPSPIRNCVNQEWPEGSSPGLTEGNTGLVRDLRPAHQDRSGTREDPAGQETTAITNPSP      1 - 70
SLAADLAGDALPGCLGAAAHQGPLLDRSSESTLGPQALELEHCHERGCCRGCASFSPFPAPRCPSERLGA     71 - 140
HSSRWAIRGRSKINPPPWAPACLPGGFPACLPAPKSSTDSASSCFKGGREFSDPLDIPGAGAMG          141 - 204
//

Text Mined References (7)

PMID Year Title
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707072 2001 From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map.
10830953 2000 The DNA sequence of human chromosome 21.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.