Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.6e-05

Synonym

Accession P58512 P58556 Q495D3 Q495D5
Symbols PRED54
C21orf67
C21orf69

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MGWDCRRTTVENPSPIRNCVNQEWPEGSSPGLTEGNTGLVRDLRPAHQDRSGTREDPAGQETTAITNPSP      1 - 70
SLAADLAGDALPGCLGAAAHQGPLLDRSSESTLGPQALELEHCHERGCCRGCASFSPFPAPRCPSERLGA     71 - 140
HSSRWAIRGRSKINPPPWAPACLPGGFPACLPAPKSSTDSASSCFKGGREFSDPLDIPGAGAMG          141 - 204
//

Text Mined References (7)

PMID Year Title