Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.04
PubTator Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Down syndrome 548 3.229 1.6

Expression

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN                  1 - 58
//

Text Mined References (8)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036298 2002 Annotation of human chromosome 21 for relevance to Down syndrome: gene structure and expression analysis.
11707072 2001 From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map.
10830953 2000 The DNA sequence of human chromosome 21.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.