Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.54
PubTator Score 0.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 5.31534891990245E-8
posterior fossa group B ependymoma 1530 6.99699887343017E-6
group 3 medulloblastoma 2254 5.58768808499653E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00716673632376586

Expression

  Differential Expression (4)

Synonym

Accession P58505 B3KPI1 Q8N7N9
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

 Compartment GO Term (2)

AA Sequence

MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAWAPAEQFFPASNRTREGGGLW      1 - 70
PPLPLQSSPAAPTMLDSSAAEQVTRLTLKLLGQKLEQERQNVEGGPEGLHLEPGNEDRPDDALQTALKRR     71 - 140
RDLLQRLREQHLLDELSRAQAWSGPSRGALGSALPPELPPTGILPTASPSPLAPDPPRIILPTVPQPPAT    141 - 210
IIQQLPQQPLIAQIPPPQAFPTQRSGSIKEDMVELLLLQNAQVHQLVLQNWMLKALPPALQDPPHVPPRV    211 - 280
PRAARPRLPAVHHHHHHHHAVWPPGAATVLQPAPSLWTPGPP                                281 - 322
//

Text Mined References (7)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707072 2001 From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map.
10830953 2000 The DNA sequence of human chromosome 21.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].