Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.54
PubTator Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession P58505 B3KPI1 Q8N7N9
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAWAPAEQFFPASNRTREGGGLW      1 - 70
PPLPLQSSPAAPTMLDSSAAEQVTRLTLKLLGQKLEQERQNVEGGPEGLHLEPGNEDRPDDALQTALKRR     71 - 140
RDLLQRLREQHLLDELSRAQAWSGPSRGALGSALPPELPPTGILPTASPSPLAPDPPRIILPTVPQPPAT    141 - 210
IIQQLPQQPLIAQIPPPQAFPTQRSGSIKEDMVELLLLQNAQVHQLVLQNWMLKALPPALQDPPHVPPRV    211 - 280
PRAARPRLPAVHHHHHHHHAVWPPGAATVLQPAPSLWTPGPP                                281 - 322
//

Text Mined References (7)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707072 2001 From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map.
10830953 2000 The DNA sequence of human chromosome 21.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].